RAB12 (NM_001025300) Human Recombinant Protein
CAT#: TP311472
Recombinant protein of human RAB12, member RAS oncogene family (RAB12), 20 µg
View other "RAB12" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211472 representing NM_001025300
Red=Cloning site Green=Tags(s) MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEA CKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMI DKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPL DILRNELSNSILSLQPEPEIPPELPPPRPHVRCC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001020471 |
Locus ID | 201475 |
UniProt ID | Q6IQ22 |
Refseq Size | 2138 |
Cytogenetics | 18p11.22 |
Refseq ORF | 732 |
Summary | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab may play a role in protein transport from recycling endosomes to lysosomes regulating, for instance, the degradation of the transferrin receptor. Involved in autophagy (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422432 | RAB12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422432 | Transient overexpression lysate of RAB12, member RAS oncogene family (RAB12) |
CNY 3080.00 |
|
PH311472 | RAB12 MS Standard C13 and N15-labeled recombinant protein (NP_001020471) |
CNY 19520.00 |