PF4 (NM_002619) Human Recombinant Protein
CAT#: TP311322L
Recombinant protein of human platelet factor 4 (PF4), 1 mg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 36000.00
货期*
                        4周
                    规格
                        
                         推荐一起购买 (3)
                    
                    
                                        DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
                                    
                                CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC211322 protein sequence 
Red=Cloning site Green=Tags(s) MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTA QLIATLKNGRKICLDLQAPLYKKIIKKLLES myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 10.7 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Bioactivity | Cell treatment (PMID: 28120850) | 
| Reference Data | |
| RefSeq | NP_002610 | 
| Locus ID | 5196 | 
| UniProt ID | P02776 | 
| Refseq Size | 878 | 
| Cytogenetics | 4q13.3 | 
| Refseq ORF | 303 | 
| Synonyms | CXCL4; PF-4; SCYB4 | 
| Summary | This gene encodes a member of the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. This protein is chemotactic for numerous other cell type and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. The protein also exhibits antimicrobial activity against Plasmodium falciparum. [provided by RefSeq, Oct 2014] | 
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane | 
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction | 
Documents
| FAQs | 
| SDS | 
            You may also need
        
        
    
                         Customer
                                Reviews 
                    
                    
                                Loading...
                            
                        