NLRP10 (NM_176821) Human Recombinant Protein
CAT#: TP311215
Recombinant protein of human NLR family, pyrin domain containing 10 (NLRP10), 20 µg
View other "NLRP10" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC211215 protein sequence
Red=Cloning site Green=Tags(s) MAMAKARKPREALLWALSDLEENDFKKLKFYLRDMTLSEGQPPLARGELEGLIPVDLAELLISKYGEKEA VKVVLKGLKVMNLLELVDQLSHICLHDYREVYREHVRCLEEWQEAGVNGRYNQVLLVAKPSSESPESLAC PFPEQELESVTVEALFDSGEKPSLAPSLVVLQGSAGTGKTTLARKMVLDWATGTLYPGRFDYVFYVSCKE VVLLLESKLEQLLFWCCGDNQAPVTEILRQPERLLFILDGFDELQRPFEEKLKKRGLSPKESLLHLLIRR HTLPTCSLLITTRPLALRNLEPLLKQARHVHILGFSEEERARYFSSYFTDEKQADRAFDIVQKNDILYKA CQVPGICWVVCSWLQGQMERGKVVLETPRNSTDIFMAYVSTFLPPDDDGGCSELSRHRVLRSLCSLAAEG IQHQRFLFEEAELRKHNLDGPRLAAFLSSNDYQLGLAIKKFYSFRHISFQDFFHAMSYLVKEDQSRLGKE SRREVQRLLEVKEQEGNDEMTLTMQFLLDISKKDSFSNLELKFCFRISPCLAQDLKHFKEQMESMKHNRT WDLEFSLYEAKIKNLVKGIQMNNVSFKIKHSNEKKSQSQNLFSVKSSLSHGPKEEQKCPSVHGQKEGKDN IAGTQKEASTGKGRGTEETPKNTYI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 74.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_789791 |
| Locus ID | 338322 |
| UniProt ID | Q86W26 |
| Refseq Size | 2020 |
| Cytogenetics | 11p15.4 |
| Refseq ORF | 1965 |
| Synonyms | CLR11.1; NALP10; NOD8; PAN5; PYNOD |
| Summary | Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminal leucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). The protein encoded by this gene belongs to the NALP protein family despite lacking the LRR region. This protein likely plays a regulatory role in the innate immune system. The protein belongs to the signal-induced multiprotein complex, the inflammasome, that activates the pro-inflammatory caspases, caspase-1 and caspase-5. Other experiments indicate that this gene acts as a multifunctional negative regulator of inflammation and apoptosis. [provided by RefSeq, Jul 2008] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Glial Uptake of Amyloid Beta Induces NLRP3 Inflammasome Formation via Cathepsin-Dependent Degradation of NLRP10
,Murphy, N;Grehan, B;Lynch, MA;,
Neuromolecular Med.
,PubMed ID 24197756
[NLRP10]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406109 | NLRP10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406109 | Transient overexpression lysate of NLR family, pyrin domain containing 10 (NLRP10) |
CNY 3080.00 |
|
| PH311215 | NLRP10 MS Standard C13 and N15-labeled recombinant protein (NP_789791) |
CNY 19520.00 |
