PPPDE2 (DESI1) (NM_015704) Human Recombinant Protein
CAT#: TP310892
Recombinant protein of human PPPDE peptidase domain containing 2 (PPPDE2), 20 µg
View other "PPPDE2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210892 protein sequence
Red=Cloning site Green=Tags(s) MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDS VVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPF GQALRPLLDSIQIQPPGGSSVGRPNGQS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056519 |
Locus ID | 27351 |
UniProt ID | Q6ICB0 |
Refseq Size | 3804 |
Cytogenetics | 22q13.2 |
Refseq ORF | 504 |
Synonyms | D15Wsu75e; DeSI-1; DESI2; DJ347H13.4; FAM152B; POST; PPPDE2 |
Summary | Protease which deconjugates SUMO1, SUMO2 and SUMO3 from some substrate proteins. Has isopeptidase but not SUMO-processing activity (By similarity). Desumoylates ZBTB46 (By similarity). Collaborates with UBQLN4 in the export of ubiquitinated proteins from the nucleus to the cytoplasm (PubMed:29666234).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414397 | DESI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414397 | Transient overexpression lysate of PPPDE peptidase domain containing 2 (PPPDE2) |
CNY 3080.00 |
|
PH310892 | PPPDE2 MS Standard C13 and N15-labeled recombinant protein (NP_056519) |
CNY 19520.00 |