TRIM10 (NM_052828) Human Recombinant Protein
CAT#: TP310882
Recombinant protein of human tripartite motif-containing 10 (TRIM10), transcript variant 2, 20 µg
View other "TRIM10" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210882 protein sequence
Red=Cloning site Green=Tags(s) MASAASVTSLADEVNCPICQGTLREPVTIDCGHNFCRACLTRYCEIPGPDLEESPTCPLCKEPFRPGSFR PNWQLANVVENIERLQLVSTLGLGEEDVCQEHGEKIYFFCEDDEMQLCVVCREAGEHATHTMRFLEDAAA PYREQIHKCLKCLRKEREEIQEIQSRENKRMQVLLTQVSTKRQQVISEFAHLRKFLEEQQSILLAQLESQ DGDILRQRDEFDLLVAGEICRFSALIEELEEKNERPARELLTDIRSTLIRCETRKCRKPVAVSPELGQRI RDFPQQALPLQREMKMFLEKLCFELDYEPAHISLDPQTSHPKLLLSEDHQRAQFSYKWQNSPDNPQRFDR ATCVLAHTGITGGRHTWVWMARVPGDSGCCQFCSPPSVLGTEVAA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 45.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_439893 |
| Locus ID | 10107 |
| UniProt ID | Q9UDY6 |
| Refseq Size | 3033 |
| Cytogenetics | 6p22.1 |
| Refseq ORF | 1185 |
| Synonyms | HERF1; RFB30; RNF9 |
| Summary | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. Alternate splicing of this gene generates two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409443 | TRIM10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416423 | TRIM10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY409443 | Transient overexpression lysate of tripartite motif-containing 10 (TRIM10), transcript variant 2 |
CNY 3080.00 |
|
| LY416423 | Transient overexpression lysate of tripartite motif-containing 10 (TRIM10), transcript variant 1 |
CNY 4840.00 |
|
| PH310882 | TRIM10 MS Standard C13 and N15-labeled recombinant protein (NP_439893) |
CNY 19520.00 |
