GNG13 (NM_016541) Human Recombinant Protein
CAT#: TP310828
Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 13 (GNG13), 20 µg
View other "GNG13" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210828 protein sequence
Red=Cloning site Green=Tags(s) MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 7.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057625 |
| Locus ID | 51764 |
| UniProt ID | Q9P2W3 |
| Refseq Size | 1001 |
| Cytogenetics | 16p13.3 |
| Refseq ORF | 201 |
| Synonyms | G(gamma)13; h2-35 |
| Summary | Heterotrimeric G proteins, which consist of alpha (see MIM 139320), beta (see MIM 139380), and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction (Li et al., 2006 [PubMed 16473877]).[supplied by OMIM, Oct 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Chemokine signaling pathway, Taste transduction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413914 | GNG13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413914 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 13 (GNG13) |
CNY 3080.00 |
|
| PH310828 | GNG13 MS Standard C13 and N15-labeled recombinant protein (NP_057625) |
CNY 19520.00 |
