LIF (NM_002309) Human Recombinant Protein
CAT#: TP310818
Recombinant protein of human leukemia inhibitory factor (cholinergic differentiation factor) (LIF), 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210818 protein sequence
Red=Cloning site Green=Tags(s) MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQ GEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNAT ADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002300 |
| Locus ID | 3976 |
| UniProt ID | P15018 |
| Refseq Size | 3987 |
| Cytogenetics | 22q12.2 |
| Refseq ORF | 606 |
| Synonyms | CDF; DIA; HILDA; MLPLI |
| Summary | The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012] |
| Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
| Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400835 | LIF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400835 | Transient overexpression lysate of leukemia inhibitory factor (cholinergic differentiation factor) (LIF) |
CNY 3080.00 |
|
| PH310818 | LIF MS Standard C13 and N15-labeled recombinant protein (NP_002300) |
CNY 19520.00 |
|
| TP720015 | Recombinant protein of human leukemia inhibitory factor (cholinergic differentiation factor) (LIF) |
CNY 3140.00 |
|
| TP723889 | Purified recombinant protein of Human leukemia inhibitory factor (cholinergic differentiation factor) (LIF) |
CNY 4000.00 |
|
| TP750008 | Recombinant protein of human leukemia inhibitory factor (LIF) produced in E. coli. |
CNY 2040.00 |
