TXNIP (NM_006472) Human Recombinant Protein
CAT#: TP310804
Recombinant protein of human thioredoxin interacting protein (TXNIP), 20 µg
View other "TXNIP" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
热销蛋白,享双倍赠礼
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210804 protein sequence
Red=Cloning site Green=Tags(s) MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYL RYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETK KNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVV PKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYV SVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTP LLDDMDGSQDSPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006463 |
Locus ID | 10628 |
UniProt ID | Q9H3M7 |
Refseq Size | 2979 |
Cytogenetics | 1q21.1 |
Refseq ORF | 1173 |
Synonyms | ARRDC6; EST01027; HHCPA78; THIF; VDUP1 |
Summary | This gene encodes a thioredoxin-binding protein that is a member of the alpha arrestin protein family. Thioredoxin is a thiol-oxidoreductase that is a major regulator of cellular redox signaling which protects cells from oxidative stress. This protein inhibits the antioxidative function of thioredoxin resulting in the accumulation of reactive oxygen species and cellular stress. This protein also functions as a regulator of cellular metabolism and of endoplasmic reticulum (ER) stress. This protein may also function as a tumor suppressor. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
TXNIP Regulates Natural Killer Cell-Mediated Innate Immunity by Inhibiting IFN-γ Production during Bacterial Infection
,Kim, DO;Byun, JE;Kim, WS;Kim, MJ;Choi, JH;Kim, H;Choi, E;Kim, TD;Yoon, SR;Noh, JY;Park, YJ;Lee, J;Cho, HJ;Lee, HG;Min, SH;Choi, I;Jung, H;,
International journal of molecular sciences
,PubMed ID 33327533
[TXNIP]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401945 | TXNIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401945 | Transient overexpression lysate of thioredoxin interacting protein (TXNIP) |
CNY 3,080.00 |
|
PH310804 | TXNIP MS Standard C13 and N15-labeled recombinant protein (NP_006463) |
CNY 19,520.00 |