LECT2 (NM_002302) Human Recombinant Protein
CAT#: TP310790M
Recombinant protein of human leukocyte cell-derived chemotaxin 2 (LECT2), 100 µg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 9998.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC210790 protein sequence 
Red=Cloning site Green=Tags(s) MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAPF TGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIE NCDSSDPTAYL myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 14.5 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Bioactivity | Cell treatment (PMID: 26123523) | 
| Reference Data | |
| RefSeq | NP_002293 | 
| Locus ID | 3950 | 
| UniProt ID | O14960 | 
| Refseq Size | 1077 | 
| Cytogenetics | 5q31.1 | 
| Refseq ORF | 453 | 
| Synonyms | chm-II; chm2 | 
| Summary | This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome, Secreted Protein | 
Documents
| FAQs | 
| SDS | 
