ROMO1 (NM_080748) Human Recombinant Protein
CAT#: TP310655
Recombinant protein of human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein, 20 µg
View other "ROMO1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210655 protein sequence
Red=Cloning site Green=Tags(s) MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTF MAIGMGIRC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 8 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_542786 |
| Locus ID | 140823 |
| UniProt ID | P60602 |
| Refseq Size | 477 |
| Cytogenetics | 20q11.22 |
| Refseq ORF | 237 |
| Synonyms | bA353C18.2; C20orf52; MTGM; MTGMP |
| Summary | The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage. [provided by RefSeq, Nov 2014] |
| Protein Families | Transmembrane |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Overexpression of Romo1 is an unfavorable prognostic biomarker and a predictor of lymphatic metastasis in non-small cell lung cancer patients
,null,
OncoTargets and therapy
,PubMed ID 30087567
[ROMO1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409065 | ROMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409065 | Transient overexpression lysate of reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| PH310655 | ROMO1 MS Standard C13 and N15-labeled recombinant protein (NP_542786) |
CNY 19520.00 |


