TRAPPC2L (NM_016209) Human Recombinant Protein
CAT#: TP310647
Recombinant protein of human trafficking protein particle complex 2-like (TRAPPC2L), 20 µg
View other "TRAPPC2L" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210647 protein sequence
Red=Cloning site Green=Tags(s) MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVY GYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057293 |
Locus ID | 51693 |
UniProt ID | Q9UL33 |
Refseq Size | 637 |
Cytogenetics | 16q24.3 |
Refseq ORF | 420 |
Synonyms | HSPC176; PERRB |
Summary | This gene encodes a protein that interacts with the tethering factor trafficking protein particle (TRAPP complex). TRAPP complexes mediate the contact between vescicles and target membranes, and thus, are involved in vescicle-mediated transport of proteins and lipids. The encoded protein is related to the X-linked trafficking protein particle complex 2. A related pseudogene is located on the X chromosome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414123 | TRAPPC2L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414123 | Transient overexpression lysate of trafficking protein particle complex 2-like (TRAPPC2L) |
CNY 3080.00 |
|
PH310647 | TRAPPC2L MS Standard C13 and N15-labeled recombinant protein (NP_057293) |
CNY 19520.00 |
其它TRAPPC2L产品