INPP1 (NM_002194) Human Recombinant Protein
CAT#: TP310604
Recombinant protein of human inositol polyphosphate-1-phosphatase (INPP1), transcript variant 2, 20 µg
View other "INPP1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210604 protein sequence
Red=Cloning site Green=Tags(s) MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNMENKFP GLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDSTE INVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQCVTILIGVYDIQTGVPLMGVINQPFVSRDP NTLRWKGQCYWGLSYMGTNMHSLQLTISRRNGSETHTGNTGSEAAFSPSFSAVISTSEKETIKAALSRVC GDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQ LVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 43.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002185 |
| Locus ID | 3628 |
| UniProt ID | P49441 |
| Refseq Size | 2035 |
| Cytogenetics | 2q32.2 |
| Refseq ORF | 1197 |
| Summary | This gene encodes the enzyme inositol polyphosphate-1-phosphatase, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisphosphate and inositol 1,3,4-trisphophosphate. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419477 | INPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427029 | INPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419477 | Transient overexpression lysate of inositol polyphosphate-1-phosphatase (INPP1), transcript variant 2 |
CNY 3080.00 |
|
| LY427029 | Transient overexpression lysate of inositol polyphosphate-1-phosphatase (INPP1), transcript variant 1 |
CNY 3080.00 |
|
| PH310604 | INPP1 MS Standard C13 and N15-labeled recombinant protein (NP_002185) |
CNY 19520.00 |
