MORN4 (NM_178832) Human Recombinant Protein
CAT#: TP310584
Recombinant protein of human MORN repeat containing 4 (MORN4), transcript variant 1, 20 µg
View other "MORN4" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210584 protein sequence
Red=Cloning site Green=Tags(s) MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGK FNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKS ARNLTA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_849154 |
Locus ID | 118812 |
UniProt ID | Q8NDC4 |
Refseq Size | 2441 |
Cytogenetics | 10q24.2 |
Refseq ORF | 438 |
Synonyms | bA548K23.4; C10orf83; rtp; UTA |
Summary | Plays a role in promoting axonal degeneration following neuronal injury by toxic insult or trauma.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405849 | MORN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420358 | MORN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405849 | Transient overexpression lysate of MORN repeat containing 4 (MORN4), transcript variant 1 |
CNY 3080.00 |
|
LY420358 | Transient overexpression lysate of MORN repeat containing 4 (MORN4), transcript variant 2 |
CNY 3080.00 |
|
PH310584 | MORN4 MS Standard C13 and N15-labeled recombinant protein (NP_849154) |
CNY 19520.00 |