ATG5 (NM_004849) Human Recombinant Protein
CAT#: TP310563
Recombinant protein of human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), 20 µg
View other "ATG5" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210563 protein sequence
Red=Cloning site Green=Tags(s) MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWF EYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQ VINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADG QLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004840 |
Locus ID | 9474 |
UniProt ID | Q9H1Y0 |
Refseq Size | 3260 |
Cytogenetics | 6q21 |
Refseq ORF | 825 |
Synonyms | APG5; APG5-LIKE; APG5L; ASP; hAPG5; SCAR25 |
Summary | The protein encoded by this gene, in combination with autophagy protein 12, functions as an E1-like activating enzyme in a ubiquitin-like conjugating system. The encoded protein is involved in several cellular processes, including autophagic vesicle formation, mitochondrial quality control after oxidative damage, negative regulation of the innate antiviral immune response, lymphocyte development and proliferation, MHC II antigen presentation, adipocyte differentiation, and apoptosis. Several transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Sep 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Regulation of autophagy, RIG-I-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401532 | ATG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401532 | Transient overexpression lysate of ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5) |
CNY 3080.00 |
|
PH310563 | ATG5 MS Standard C13 and N15-labeled recombinant protein (NP_004840) |
CNY 19520.00 |
|
TP720995 | Purified recombinant protein of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5) |
CNY 1800.00 |