RAB21 (NM_014999) Human Recombinant Protein
CAT#: TP310510
Recombinant protein of human RAB21, member RAS oncogene family (RAB21), 20 µg
View other "RAB21" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210510 protein sequence
Red=Cloning site Green=Tags(s) MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNL AIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKER HVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDD EPQAQTSGGGCCSSG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055814 |
Locus ID | 23011 |
UniProt ID | Q9UL25 |
Refseq Size | 2627 |
Cytogenetics | 12q21.1 |
Refseq ORF | 675 |
Summary | This gene belongs to the Rab family of monomeric GTPases, which are involved in the control of cellular membrane traffic. The encoded protein plays a role in the targeted trafficking of integrins via its association with integrin alpha tails. As a consequence, the encoded protein is involved in the regulation of cell adhesion and migration. Expression of this gene is associated with a poor prognosis for glioma patients. This gene is downregulated by the tumor suppressor miR-200b, and miRNA-200b is itself downregulated in glioma tissues. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402398 | RAB21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402398 | Transient overexpression lysate of RAB21, member RAS oncogene family (RAB21) |
CNY 3080.00 |
|
PH310510 | RAB21 MS Standard C13 and N15-labeled recombinant protein (NP_055814) |
CNY 19520.00 |