Nkx3.1 (NKX3-1) (NM_006167) Human Recombinant Protein
CAT#: TP310374M
Recombinant protein of human NK3 homeobox 1 (NKX3-1), 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210374 protein sequence
Red=Cloning site Green=Tags(s) MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAG AQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELE RKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASL VSVYNSYPYYPYLYCVGSWSPAFW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006158 |
| Locus ID | 4824 |
| UniProt ID | Q99801 |
| Refseq Size | 3281 |
| Cytogenetics | 8p21.2 |
| Refseq ORF | 702 |
| Synonyms | BAPX2; NKX3; NKX3.1; NKX3A |
| Summary | This gene encodes a homeobox-containing transcription factor. This transcription factor functions as a negative regulator of epithelial cell growth in prostate tissue. Aberrant expression of this gene is associated with prostate tumor progression. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jan 2012] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Pathways in cancer, Prostate cancer |
Documents
| FAQs |
| SDS |
