PD1 (PDCD1) (NM_005018) Human Recombinant Protein
CAT#: TP310364
Recombinant protein of human programmed cell death 1 (PDCD1), 20 µg
View other "PD1" proteins (18)
| Need it in bulk or customized? Get a free quote | Avi-tag Biotinylated Protein Get a free quote | 
CNY 2900.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | >RC210364 protein sequence Red=Cloning site Green=Tags(s) MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRA ELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLK EDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPE DGHCSWPL myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Predicted MW | 29.2 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_005009 | 
| Locus ID | 5133 | 
| UniProt ID | Q15116 | 
| Refseq Size | 2115 | 
| Cytogenetics | 2q37.3 | 
| Refseq ORF | 864 | 
| Synonyms | CD279; hPD-1; hPD-l; hSLE1; PD-1; PD1; SLEB2 | 
| Summary | Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells; it is involved in the regulation of T-cell functions, including those of effector CD8+ T cells. In addition, this protein can also promote the differentiation of CD4+ T cells into T regulatory cells. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, this protein has been shown to be involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity. [provided by RefSeq, Aug 2020] | 
| Protein Families | Druggable Genome, Transmembrane | 
| Protein Pathways | Cell adhesion molecules (CAMs), T cell receptor signaling pathway | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401555 | PDCD1 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY401555 | Transient overexpression lysate of programmed cell death 1 (PD-1 / PDCD1) | CNY 3080.00 | |
| PH310364 | PD-1 / PDCD1 MS Standard C13 and N15-labeled recombinant protein (NP_005009) | CNY 19520.00 | |
| TP700198 | Purified recombinant protein of Homo sapiens programmed cell death 1 (PDCD1), 25-167aa, with C-terminal DDK/His tag, expressed in HEK293 cells. | CNY 6650.00 | |
| TP700199 | Purified recombinant protein of Homo sapiens programmed cell death 1 (PD1/PDCD1), residues 25-167aa, with C-terminal Fc tag, expressed in HEK293 cells. | CNY 6650.00 | |
| TP721292 | Human PD1 Protein (C-His) | CNY 2450.00 | |
| TP721293 | Human PD1 Protein (C-His-Avi) | CNY 2450.00 | |
| TP721294 | Biotinylated Human PD1 Protein (C-His-Avi) | CNY 3480.00 | |
| TP721295 | PE Conjugated Human PD1 Protein (C-His) | CNY 3480.00 | |
| TP721296 | APC Conjugated Human PD1 Protein (C-His) | CNY 3480.00 | |
| TP721297 | Human PD1 Protein (C-Fc) | CNY 2450.00 | |
| TP721298 | Human PD1 Protein (C-Fc-Avi) | CNY 2450.00 | |
| TP721299 | Biotinylated Human PD1 Protein (C-Fc-Avi) | CNY 3480.00 | |
| TP721300 | PE Conjugated Human PD1 Protein (C-Fc) | CNY 3480.00 | |
| TP721301 | APC Conjugated Human PD1 Protein (C-Fc) | CNY 3480.00 | |
| TP723948 | Human PD-1 Protein, mFc-His tag | CNY 5876.00 | |
| TP723998 | Human PD-1 Protein, His tag | CNY 4925.00 | |
| TP723999 | Human PD-1 Protein, hFc-His tag | CNY 5552.00 | 


 
                        

 
        