FNTA (NM_002027) Human Recombinant Protein
CAT#: TP310293
Purified recombinant protein of Homo sapiens farnesyltransferase, CAAX box, alpha (FNTA), transcript variant 1, 20 µg
View other "FNTA" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210293 protein sequence
Red=Cloning site Green=Tags(s) MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRA EWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVL LKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVI QEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYL KGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDT IRKEYWRYIGRSLQSKHSTENDSPTNVQQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 44.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002018 |
| Locus ID | 2339 |
| UniProt ID | P49354 |
| Refseq Size | 1710 |
| Cytogenetics | 8p11.21 |
| Refseq ORF | 1137 |
| Synonyms | FPTA; PGGT1A; PTAR2 |
| Summary | Prenyltransferases can attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of proteins with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419578 | FNTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419578 | Transient overexpression lysate of farnesyltransferase, CAAX box, alpha (FNTA), transcript variant 1 |
CNY 3080.00 |
|
| PH310293 | FNTA MS Standard C13 and N15-labeled recombinant protein (NP_002018) |
CNY 14250.00 |
