ARL4C (NM_005737) Human Recombinant Protein
CAT#: TP310286
Recombinant protein of human ADP-ribosylation factor-like 4C (ARL4C), 20 µg
View other "ARL4C" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210286 protein sequence
Red=Cloning site Green=Tags(s) MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVG GQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEI EKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005728 |
Locus ID | 10123 |
UniProt ID | P56559 |
Refseq Size | 4024 |
Cytogenetics | 2q37.1 |
Refseq ORF | 576 |
Synonyms | ARL7; LAK |
Summary | ADP-ribosylation factor-like 4C is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4C is closely similar to ARL4A and ARL4D and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417097 | ARL4C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417097 | Transient overexpression lysate of ADP-ribosylation factor-like 4C (ARL4C) |
CNY 3080.00 |
|
PH310286 | ARL4C MS Standard C13 and N15-labeled recombinant protein (NP_005728) |
CNY 19520.00 |