MARK2 (NM_004954) Human Recombinant Protein
CAT#: TP310279
Recombinant protein of human MAP/microtubule affinity-regulating kinase 2 (MARK2), transcript variant 2, 20 µg
View other "MARK2" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210279 protein sequence
Red=Cloning site Green=Tags(s) MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLA RHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDY LVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFC GSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENL LKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQR YNEVMATYLLLGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAGPAIPTSN SYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLER ASLGQASIQNGKDSTAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAGQLRQVRDQQNLPYGV TPASPSGHSQGRRGASGSIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLR FTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVR FKRISGTSMAFKNIASKIANELKL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 81 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004945 |
| Locus ID | 2011 |
| UniProt ID | Q7KZI7 |
| Refseq Size | 4556 |
| Cytogenetics | 11q13.1 |
| Refseq ORF | 2172 |
| Synonyms | EMK-1; EMK1; PAR-1; Par-1b; Par1b |
| Summary | This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inactivation of several microtubule-associating proteins. The protein localizes to cell membranes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2009] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413771 | MARK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC417631 | MARK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413771 | Transient overexpression lysate of MAP/microtubule affinity-regulating kinase 2 (MARK2), transcript variant 1 |
CNY 4840.00 |
|
| LY417631 | Transient overexpression lysate of MAP/microtubule affinity-regulating kinase 2 (MARK2), transcript variant 3 |
CNY 3080.00 |
|
| PH310279 | MARK2 MS Standard C13 and N15-labeled recombinant protein (NP_004945) |
CNY 19520.00 |
|
| TP760915 | Purified recombinant protein of Human MAP/microtubule affinity-regulating kinase 2 (MARK2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
