RPA4 (NM_013347) Human Recombinant Protein
CAT#: TP310239
Recombinant protein of human replication protein A4, 34kDa (RPA4), 20 µg
View other "RPA4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210239 protein sequence
Red=Cloning site Green=Tags(s) MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGII VSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSL EVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIH ECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_037479 |
| Locus ID | 29935 |
| UniProt ID | Q13156 |
| Refseq Size | 1560 |
| Cytogenetics | Xq21.33 |
| Refseq ORF | 783 |
| Synonyms | HSU24186 |
| Summary | This gene encodes a single-stranded DNA-binding protein that is the 30-kDa subunit of the replication protein A complex. Replication protein A is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. The encoded protein localizes to DNA repair foci and may be involved in the cellular DNA damage response. This protein may also play a role in inhibiting viral replication.[provided by RefSeq, Apr 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | DNA replication, Homologous recombination, Mismatch repair, Nucleotide excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415651 | RPA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415651 | Transient overexpression lysate of replication protein A4, 34kDa (RPA4) |
CNY 3080.00 |
|
| PH310239 | RPA4 MS Standard C13 and N15-labeled recombinant protein (NP_037479) |
CNY 19520.00 |
