RGS8 (NM_033345) Human Recombinant Protein
CAT#: TP310236
Recombinant protein of human regulator of G-protein signaling 8 (RGS8), transcript variant 1, 20 µg
View other "RGS8" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210236 protein sequence
Red=Cloning site Green=Tags(s) MWNTLTRSLSDHPVGKDPQAMRTGQRQNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATR WADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVN IDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_203131 |
Locus ID | 85397 |
UniProt ID | P57771 |
Refseq Size | 783 |
Cytogenetics | 1q25.3 |
Refseq ORF | 594 |
Summary | This gene is a member of the regulator of G protein signaling (RGS) family and encodes a protein with a single RGS domain. Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. They accelerate transit through the cycle of GTP binding and hydrolysis to GDP, thereby terminating signal transduction, but paradoxically, also accelerate receptor-stimulated activation. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409583 | RGS8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420151 | RGS8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409583 | Transient overexpression lysate of regulator of G-protein signaling 8 (RGS8), transcript variant 1 |
CNY 3080.00 |
|
LY420151 | Transient overexpression lysate of regulator of G-protein signaling 8 (RGS8), transcript variant 2 |
CNY 3080.00 |
|
PH310236 | RGS8 MS Standard C13 and N15-labeled recombinant protein (NP_203131) |
CNY 19520.00 |