GPA33 (NM_005814) Human Recombinant Protein
CAT#: TP310225
Recombinant protein of human glycoprotein A33 (transmembrane) (GPA33), 20 µg
View other "GPA33" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210225 protein sequence
Red=Cloning site Green=Tags(s) MVGKMWPVLWTLCAVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVV IWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVP PSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYI CTSSNEEGTQFCNITVAVRSPSMNVALYVGIAVGVVAALIIIGIIIYCCCCRGKDDNTEDKEDARPNREA YEEPPEQLRELSREREEEDDYRQEEQRSTGRESPDHLDQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005805 |
| Locus ID | 10223 |
| UniProt ID | Q99795 |
| Refseq Size | 2793 |
| Cytogenetics | 1q24.1 |
| Refseq ORF | 957 |
| Synonyms | A33 |
| Summary | The glycoprotein encoded by this gene is a cell surface antigen that is expressed in greater than 95% of human colon cancers. The open reading frame encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. The predicted mature protein has a 213-amino acid extracellular region, a single transmembrane domain, and a 62-amino acid intracellular tail. The sequence of the extracellular region contains 2 domains characteristic of the CD2 subgroup of the immunoglobulin (Ig) superfamily. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417048 | GPA33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417048 | Transient overexpression lysate of glycoprotein A33 (transmembrane) (GPA33) |
CNY 3080.00 |
|
| PH310225 | GPA33 MS Standard C13 and N15-labeled recombinant protein (NP_005805) |
CNY 19520.00 |
|
| TP720397 | Purified recombinant protein of Homo sapiens glycoprotein A33 (transmembrane) (GPA33) |
CNY 1800.00 |
|
| TP762369 | Purified recombinant protein of Human glycoprotein A33 (transmembrane) (GPA33), Ile22-Val235-GGGGS-Tyr257-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
