S1PR2 (NM_004230) Human Recombinant Protein
CAT#: TP310163
Recombinant protein of human sphingosine-1-phosphate receptor 2 (S1PR2), 20 µg
View other "S1PR2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210163 protein sequence
Red=Cloning site Green=Tags(s) MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVARNSKFHSAMYL FLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASVFSLLAIAIERHVAIAKVKLY GSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACSTVLPLYAKHYVLCVVTIFSIILLAIVALYV RIYCVVRSSHADMAAPQTLALLKTVTIVLGVFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLN SLLNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGN TVV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004221 |
Locus ID | 9294 |
UniProt ID | O95136 |
Refseq Size | 3589 |
Cytogenetics | 19p13.2 |
Refseq ORF | 1061 |
Synonyms | AGR16; DFNB68; EDG-5; EDG5; Gpcr13; H218; LPB2; S1P2 |
Summary | This gene encodes a member of the G protein-coupled receptors, as well as the EDG family of proteins. The encoded protein is a receptor for sphingosine 1-phosphate, which participates in cell proliferation, survival, and transcriptional activation. Defects in this gene have been associated with congenital profound deafness. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418131 | S1PR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418131 | Transient overexpression lysate of sphingosine-1-phosphate receptor 2 (S1PR2) |
CNY 3080.00 |
|
PH310163 | S1PR2 MS Standard C13 and N15-labeled recombinant protein (NP_004221) |
CNY 19520.00 |