S1PR2 (NM_004230) Human Recombinant Protein
CAT#: TP310163
Recombinant protein of human sphingosine-1-phosphate receptor 2 (S1PR2), 20 µg
View other "S1PR2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210163 protein sequence
Red=Cloning site Green=Tags(s) MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVARNSKFHSAMYL FLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASVFSLLAIAIERHVAIAKVKLY GSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACSTVLPLYAKHYVLCVVTIFSIILLAIVALYV RIYCVVRSSHADMAAPQTLALLKTVTIVLGVFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLN SLLNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGN TVV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 38.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004221 |
| Locus ID | 9294 |
| UniProt ID | O95136 |
| Refseq Size | 3589 |
| Cytogenetics | 19p13.2 |
| Refseq ORF | 1059 |
| Synonyms | AGR16; DFNB68; EDG-5; EDG5; Gpcr13; H218; LPB2; S1P2 |
| Summary | This gene encodes a member of the G protein-coupled receptors, as well as the EDG family of proteins. The encoded protein is a receptor for sphingosine 1-phosphate, which participates in cell proliferation, survival, and transcriptional activation. Defects in this gene have been associated with congenital profound deafness. [provided by RefSeq, Mar 2016] |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
| Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418131 | S1PR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418131 | Transient overexpression lysate of sphingosine-1-phosphate receptor 2 (S1PR2) |
CNY 3080.00 |
|
| PH310163 | S1PR2 MS Standard C13 and N15-labeled recombinant protein (NP_004221) |
CNY 19520.00 |


