EIF4EBP3 (NM_003732) Human Recombinant Protein
CAT#: TP310053
Recombinant protein of human eukaryotic translation initiation factor 4E binding protein 3 (EIF4EBP3), 20 µg
View other "EIF4EBP3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210053 protein sequence
Red=Cloning site Green=Tags(s) MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTP PTAPLSKLEELKEQETEEEIPDDAQFEMDI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 10.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003723 |
| Locus ID | 8637 |
| UniProt ID | O60516 |
| Refseq Size | 728 |
| Cytogenetics | 5q31.3 |
| Refseq ORF | 300 |
| Synonyms | 4E-BP3; 4EBP3 |
| Summary | This gene encodes a member of the EIF4EBP family, which consists of proteins that bind to eukaryotic translation initiation factor 4E and regulate its assembly into EIF4F, the multi-subunit translation initiation factor that recognizes the mRNA cap structure. Read-through transcription from the neighboring upstream gene (MASK or ANKHD1) generates a transcript (MASK-BP3) that encodes a protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. [provided by RefSeq, Oct 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418472 | EIF4EBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418472 | Transient overexpression lysate of eukaryotic translation initiation factor 4E binding protein 3 (EIF4EBP3) |
CNY 3080.00 |
|
| PH310053 | EIF4EBP3 MS Standard C13 and N15-labeled recombinant protein (NP_003723) |
CNY 19520.00 |
其它EIF4EBP3产品
