LRRC32 (NM_005512) Human Recombinant Protein
CAT#: TP309831
Recombinant protein of human leucine rich repeat containing 32 (LRRC32), transcript variant 1, 20 µg
View other "LRRC32" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209831 protein sequence
Red=Cloning site Green=Tags(s) MRPQILLLLALLTLGLAAQHQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLG FYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGL LERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNLSRNSLT CISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLP TGPPQDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNC LRTFEARRLGSLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGN RVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLE ASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLE TSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINLII ILTFILVSAILLTTLAACCCVRRQKFNQQYKA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 69.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005503 |
| Locus ID | 2615 |
| UniProt ID | Q14392 |
| Refseq Size | 4327 |
| Cytogenetics | 11q13.5 |
| Refseq ORF | 1986 |
| Synonyms | CPPRDD; D11S833E; GARP |
| Summary | This gene encodes a type I membrane protein which contains 20 leucine-rich repeats. Alterations in the chromosomal region 11q13-11q14 are involved in several pathologies. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Signal peptide cleavage is essential for surface expression of a regulatory T cell surface protein, leucine rich repeat containing 32 (LRRC32)
,null,
BMC Biochemistry
,PubMed ID 21615933
[LRRC32]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401690 | LRRC32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427024 | LRRC32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401690 | Transient overexpression lysate of leucine rich repeat containing 32 (LRRC32), transcript variant 1 |
CNY 3080.00 |
|
| LY427024 | Transient overexpression lysate of leucine rich repeat containing 32 (LRRC32), transcript variant 2 |
CNY 3080.00 |
|
| PH309831 | LRRC32 MS Standard C13 and N15-labeled recombinant protein (NP_005503) |
CNY 14250.00 |
