HDDC2 (NM_016063) Human Recombinant Protein
CAT#: TP309808
Recombinant protein of human HD domain containing 2 (HDDC2), 20 µg
View other "HDDC2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209808 protein sequence
Red=Cloning site Green=Tags(s) MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRC VRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETRSSAEAKFVK QLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057147 |
Locus ID | 51020 |
UniProt ID | Q7Z4H3 |
Refseq Size | 1615 |
Cytogenetics | 6q22.31 |
Refseq ORF | 612 |
Synonyms | C6orf74; CGI-130; dJ167O5.2; NS5ATP2 |
Summary | Catalyzes the dephosphorylation of the nucleoside 5'-monophosphates deoxyadenosine monophosphate (dAMP), deoxycytidine monophosphate (dCMP), deoxyguanosine monophosphate (dGMP) and deoxythymidine monophosphate (dTMP).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414212 | HDDC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414212 | Transient overexpression lysate of HD domain containing 2 (HDDC2) |
CNY 3080.00 |
|
PH309808 | HDDC2 MS Standard C13 and N15-labeled recombinant protein (NP_057147) |
CNY 19520.00 |