LRP15 (LRRC3B) (NM_052953) Human Recombinant Protein
CAT#: TP309766
Recombinant protein of human leucine rich repeat containing 3B (LRRC3B), 20 µg
View other "LRP15" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209766 protein sequence
Red=Cloning site Green=Tags(s) MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLY LDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARA RIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTM FGWFTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_443185 |
| Locus ID | 116135 |
| UniProt ID | Q96PB8 |
| Refseq Size | 1718 |
| Cytogenetics | 3p24.1 |
| Refseq ORF | 777 |
| Synonyms | LRP15 |
| Summary | The protein encoded by this gene is a tumor suppressor, with lowered expression levels found in gastric, renal, colorectal, lung, and breast cancer tissues. The promoter of this gene is frequently hypermethylated in these cancer tissues, although the hypermethylation does not appear to be the cause of the reduced expression of this gene. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Dec 2015] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409370 | LRRC3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409370 | Transient overexpression lysate of leucine rich repeat containing 3B (LRRC3B) |
CNY 3080.00 |
|
| PH309766 | LRRC3B MS Standard C13 and N15-labeled recombinant protein (NP_443185) |
CNY 19520.00 |
