Galectin 13 (LGALS13) (NM_013268) Human Recombinant Protein
CAT#: TP309738
Recombinant protein of human lectin, galactoside-binding, soluble, 13 (LGALS13), 20 µg
View other "Galectin 13" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209738 protein sequence
Red=Cloning site Green=Tags(s) MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFG IWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037400 |
Locus ID | 29124 |
UniProt ID | Q9UHV8 |
Refseq Size | 610 |
Cytogenetics | 19q13.2 |
Refseq ORF | 417 |
Synonyms | GAL13; PLAC8; PP13 |
Summary | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene has lysophospholipase activity. It is composed of two identical subunits which are held together by disulfide bonds. This protein has structural similarity to several members of the beta-galactoside-binding S-type lectin family. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415702 | LGALS13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415702 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 13 (LGALS13) |
CNY 3080.00 |
|
PH309738 | LGALS13 MS Standard C13 and N15-labeled recombinant protein (NP_037400) |
CNY 19520.00 |
其它Galectin 13产品