TPK1 (NM_022445) Human Recombinant Protein
CAT#: TP309721
Recombinant protein of human thiamin pyrophosphokinase 1 (TPK1), transcript variant 1, 20 µg
View other "TPK1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209721 protein sequence
Red=Cloning site Green=Tags(s) MEHAFTPLEPLLSTGNLKYCLVILNQPLDNYFRHLWNKALLRACADGGANRLYDITEGERESFLPEFING DFDSIRPEVREYYATKGCELISTPDQDHTDFTKCLKMLQKKIEEKDLKVDVIVTLGGLAGRFDQIMASVN TLFQATHITPFPIIIIQEESLIYLLQPGKHRLHVDTGMEGDWCGLIPVGQPCSQVTTTGLKWNLTNDVLA FGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_071890 |
| Locus ID | 27010 |
| UniProt ID | Q9H3S4 |
| Refseq Size | 2449 |
| Cytogenetics | 7q35 |
| Refseq ORF | 729 |
| Synonyms | HTPK1; PP20; THMD5 |
| Summary | The protein encoded by this gene functions as a homodimer and catalyzes the conversion of thiamine to thiamine pyrophosphate, a cofactor for some enzymes of the glycolytic and energy production pathways. Defects in this gene are a cause of thiamine metabolism dysfunction syndrome-5. [provided by RefSeq, Apr 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Thiamine metabolism |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
The JAK2 Inhibitor Fedratinib Inhibits Thiamine Uptake - A Putative Mechanism for the Onset of Wernicke's Encephalopathy
,Zhang, Q;Zhang, Y;Diamond, S;Boer, J;Harris, JJ;Li, Y;Rupar, M;Behshad, E;Gardiner, C;Collier, P;Liu, P;Burn, T;Wynn, R;Hollis, G;Yeleswaram, S;,
Drug Metab. Dispos. July 2014
,PubMed ID 25063672
[TPK1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411708 | TPK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420935 | TPK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411708 | Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 1 |
CNY 3080.00 |
|
| LY420935 | Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 2 |
CNY 3080.00 |
|
| PH309721 | TPK1 MS Standard C13 and N15-labeled recombinant protein (NP_071890) |
CNY 19520.00 |
