EEF1A1 (NM_001402) Human Recombinant Protein
CAT#: TP309697
Recombinant protein of human eukaryotic translation elongation factor 1 alpha 1 (EEF1A1), 20 µg
View other "EEF1A1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 4 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209697 protein sequence
Red=Cloning site Green=Tags(s) MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG ITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA YTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPW FKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF APVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP GQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ELISA capture for autoantibodies (PMID: 26616590) Biolayer interferometry (BLI) assay (PMID: 26624286) Binding assay (PMID: 29588400) |
Reference Data | |
RefSeq | NP_001393 |
Locus ID | 1915 |
UniProt ID | P68104, Q6IPS9 |
Refseq Size | 3528 |
Cytogenetics | 6q13 |
Refseq ORF | 1386 |
Synonyms | CCS-3; CCS3; EE1A1; EEF-1; EEF1A; eEF1A-1; EF-Tu; EF1A; GRAF-1EF; LENG7; PTI1 |
Summary | This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Citations (4)
The use of this Proteins has been cited in the following citations: |
---|
HIV-1 Uncoating and Reverse Transcription Require eEF1A Binding to Surface-Exposed Acidic Residues of the Reverse Transcriptase Thumb Domain
,Rawle, DJ;Li, D;Swedberg, JE;Wang, L;Soares, DC;Harrich, D;,
MBio
,PubMed ID 29588400
[EEF1A1]
|
Specific Interaction between eEF1A and HIV RT Is Critical for HIV-1 Reverse Transcription and a Potential Anti-HIV Target
,Li, D;Wei, T;Rawle, DJ;Qin, F;Wang, R;Soares, DC;Jin, H;Sivakumaran, H;Lin, MH;Spann, K;Abbott, CM;Harrich, D;,
PLoS Pathog.
,PubMed ID 26624286
[EEF1A1]
|
The Level of Autoantibodies Targeting Eukaryote Translation Elongation Factor 1 a1 and Ubiquitin-Conjugating Enzyme 2L3 in Nondiabetic Young Adults
,Kim, EG;Kwak, SH;Hwang, D;Yi, EC;Park, KS;Koo, BK;Kim, KM;,
Diabetes Metab J Nov2015
,PubMed ID 26616590
[EEF1A1]
|
Identification of Novel Autoantibodies in Type 1 Diabetic Patients Using a High-Density Protein Microarray
,Koo, BK;Chae, S;Kim, KM;Kang, MJ;Kim, EG;Kwak, SH;Jung, HS;Cho, YM;Choi, SH;Park, YJ;Shin, CH;Jang, HC;Shin, CS;Hwang, D;Yi, EC;Park, KS;,
Diabetes
,PubMed ID 24947363
[EEF1A1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419954 | EEF1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419954 | Transient overexpression lysate of eukaryotic translation elongation factor 1 alpha 1 (EEF1A1) |
CNY 3,080.00 |
|
PH309697 | EEF1A1 MS Standard C13 and N15-labeled recombinant protein (NP_001393) |
CNY 19,520.00 |