TINAGL1 (NM_022164) Human Recombinant Protein
CAT#: TP309508
Recombinant protein of human tubulointerstitial nephritis antigen-like 1 (TINAGL1), 20 µg
View other "TINAGL1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209508 protein sequence
Red=Cloning site Green=Tags(s) MWRCPLGLLLLLPLAGHLALGAQQGRGRRELAPGLHLRGIRDAGGRYCQEQDLCCRGRADDCALPYLGAI CYCDLFCNRTVSDCCPDFWDFCLGVPPPFPPIQGCMHGGRIYPVLGTYWDNCNRCTCQENRQWQCDQEPC LVDPDMIKAINQGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMHEIYTVLNPGEVLPTAFEAS EKWPNLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDTHQQQGCRGGRLDGAWW FLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSND KEIMKELMENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKY WTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 52.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_071447 |
| Locus ID | 64129 |
| UniProt ID | Q9GZM7 |
| Refseq Size | 2252 |
| Cytogenetics | 1p35.2 |
| Refseq ORF | 1401 |
| Synonyms | ARG1; LCN7; LIECG3; TINAGRP |
| Summary | The protein encoded by this gene is similar in sequence to tubulointerstitial nephritis antigen, a secreted glycoprotein that is recognized by antibodies in some types of immune-related tubulointerstitial nephritis. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411719 | TINAGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411719 | Transient overexpression lysate of tubulointerstitial nephritis antigen-like 1 (TINAGL1) |
CNY 3080.00 |
|
| PH309508 | TINAGL1 MS Standard C13 and N15-labeled recombinant protein (NP_071447) |
CNY 19520.00 |
|
| TP721053 | Purified recombinant protein of Human tubulointerstitial nephritis antigen-like 1 (TINAGL1), transcript variant 1 |
CNY 3140.00 |
其它TINAGL1产品
