KLHL13 (NM_033495) Human Recombinant Protein
CAT＃: TP309484
Recombinant protein of human kelch-like 13 (Drosophila) (KLHL13), 20 µg
View other "KLHL13" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209484 protein sequence
Red=Cloning site Green=Tags(s) MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLSSHLQSSKAGPTRIFT SNTHSSVVLQGFDQLRLEGLLCDVTLMPGDTDDAFPVHRVMMASASDYFKAMFTGGMKEQDLMCIKLHGV SKVGLRKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVTLDNCVEVGRIANTYNLTE VDKYVNSFVLKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKATCRWLRLEEPRMDFAAKLMK NIRFPLMTPQELINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDTTHLVTLGGVLR QQLVVSKELRMYDEKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNK WMQVASLNEKRTFFHLSALKGYLYAVGGRNAAGELPTVECYNPRTNEWTYVAKMSEPHYGHAGTVYGGVM YISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRGLHCMCTVGERLYVIGGNHFRGTSDYDDVLSCEYY SPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPDKDEWHKVFDLPESLGGIR ACTLTVFPPEETTPSPSRESPLSAP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 73.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_277030 |
| Locus ID | 90293 |
| UniProt ID | Q9P2N7 |
| Refseq Size | 3991 |
| Cytogenetics | Xq24 |
| Refseq ORF | 1965 |
| Synonyms | BKLHD2 |
| Summary | This gene encodes a BTB and kelch domain containing protein and belongs to the kelch repeat domain containing superfamily of proteins. The encoded protein functions as an adaptor protein that complexes with Cullin 3 and other proteins to form the Cullin 3-based E3 ubiquitin-protein ligase complex. This complex is necessary for proper chromosome segregation and completion of cytokinesis. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409529 | KLHL13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433380 | KLHL13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433401 | KLHL13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409529 | Transient overexpression lysate of kelch-like 13 (Drosophila) (KLHL13), transcript variant 1 |
CNY 3080.00 |
|
| LY433380 | Transient overexpression lysate of kelch-like 13 (Drosophila) (KLHL13), transcript variant 4 |
CNY 3080.00 |
|
| LY433401 | Transient overexpression lysate of kelch-like 13 (Drosophila) (KLHL13), transcript variant 2 |
CNY 3080.00 |
|
| PH309484 | KLHL13 MS Standard C13 and N15-labeled recombinant protein (NP_277030) |
CNY 19520.00 |
