LYPLA3 (PLA2G15) (NM_012320) Human Recombinant Protein
CAT#: TP309446
Recombinant protein of human phospholipase A2, group XV (PLA2G15), 20 µg
View other "LYPLA3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209446 protein sequence
Red=Cloning site Green=Tags(s) MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTE SYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHT MVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQR QPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEK VFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDR DPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036452 |
Locus ID | 23659 |
UniProt ID | Q8NCC3 |
Refseq Size | 2764 |
Cytogenetics | 16q22.1 |
Refseq ORF | 1236 |
Synonyms | ACS; GXVPLA2; LLPL; LPLA2; LYPLA3 |
Summary | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid. This enzyme is present in the plasma and thought to be associated with high-density lipoprotein. A later paper contradicts the function of this gene. It demonstrates that this gene encodes a lysosomal enzyme instead of a lysophospholipase and has both calcium-independent phospholipase A2 and transacylase activities. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Protein Pathways | Glycerophospholipid metabolism, Lysosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415835 | PLA2G15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415835 | Transient overexpression lysate of phospholipase A2, group XV (PLA2G15) |
CNY 3080.00 |
|
PH309446 | PLA2G15 MS Standard C13 and N15-labeled recombinant protein (NP_036452) |
CNY 19520.00 |