Selenophosphate synthetase 1 (SEPHS1) (NM_012247) Human Recombinant Protein
CAT#: TP309406
Recombinant protein of human selenophosphate synthetase 1 (SEPHS1), 20 µg
View other "Selenophosphate synthetase 1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209406 protein sequence
Red=Cloning site Green=Tags(s) MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDT CVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKV MPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVA VHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAK QQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQ AWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036379 |
Locus ID | 22929 |
UniProt ID | P49903 |
Refseq Size | 3275 |
Cytogenetics | 10p13 |
Refseq ORF | 1176 |
Synonyms | SELD; SPS; SPS1 |
Summary | This gene encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons. [provided by RefSeq, Sep 2010] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Metabolic pathways, Selenoamino acid metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415883 | SEPHS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434161 | SEPHS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415883 | Transient overexpression lysate of selenophosphate synthetase 1 (SEPHS1) |
CNY 3080.00 |
|
LY434161 | Transient overexpression lysate of selenophosphate synthetase 1 (SEPHS1), transcript variant 3 |
CNY 3080.00 |
|
PH309406 | SEPHS1 MS Standard C13 and N15-labeled recombinant protein (NP_036379) |
CNY 19520.00 |
|
TP710322 | Purified recombinant protein of Human aprataxin and PNKP like factor (APLF), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
|
TP760692 | Purified recombinant protein of Human selenophosphate synthetase 1 (SEPHS1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它Selenophosphate synthetase 1产品