Pyrophosphatase 1 (PPA1) (NM_021129) Human Recombinant Protein
CAT#: TP309393
Recombinant protein of human pyrophosphatase (inorganic) 1 (PPA1), 20 µg
View other "Pyrophosphatase 1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209393 protein sequence
Red=Cloning site Green=Tags(s) MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIK QDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKV LGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEF KDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDV DKWFHHQKN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_066952 |
| Locus ID | 5464 |
| UniProt ID | Q15181 |
| Refseq Size | 1316 |
| Cytogenetics | 10q22.1 |
| Refseq ORF | 867 |
| Synonyms | HEL-S-66p; IOPPP; PP; PP1; SID6-8061 |
| Summary | The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme. [provided by RefSeq, Jul 2008] |
| Protein Families | ES Cell Differentiation/IPS |
| Protein Pathways | Oxidative phosphorylation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412068 | PPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412068 | Transient overexpression lysate of pyrophosphatase (inorganic) 1 (PPA1) |
CNY 3080.00 |
|
| PH309393 | PPA1 MS Standard C13 and N15-labeled recombinant protein (NP_066952) |
CNY 19520.00 |
其它Pyrophosphatase 1产品
