SPANXN3 (NM_001009609) Human Recombinant Protein
CAT#: TP309390
Recombinant protein of human SPANX family, member N3 (SPANXN3), 20 µg
View other "SPANXN3" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209390 protein sequence
Red=Cloning site Green=Tags(s) MEQPTSSTNGEKTKSPCESNNKKNDEMQEVPNRVLAPEQSLKKTKTSEYPIIFVYYLRKGKKINSNQLEN EQSQENSINPIQKEEDEGVDLSEGSSNEDEDLGPCEGPSKEDKDLDSSEGSSQEDEDLGLSEGSSQDSGE D myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001009609 |
Locus ID | 139067 |
UniProt ID | Q5MJ09 |
Refseq Size | 606 |
Cytogenetics | Xq27.3 |
Refseq ORF | 423 |
Synonyms | CT11.8; SPANX-N3 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422924 | SPANXN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422924 | Transient overexpression lysate of SPANX family, member N3 (SPANXN3) |
CNY 3080.00 |
|
PH309390 | SPANXN3 MS Standard C13 and N15-labeled recombinant protein (NP_001009609) |
CNY 19520.00 |
|
TP760186 | Recombinant protein of human SPANX family, member N3 (SPANXN3), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它SPANXN3产品