Dermcidin (DCD) (NM_053283) Human Recombinant Protein
CAT#: TP309352
Recombinant protein of human dermcidin (DCD), 20 µg
View other "Dermcidin" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC209352 protein sequence 
Red=Cloning site Green=Tags(s) MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGL DGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 9.2 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_444513 | 
| Locus ID | 117159 | 
| UniProt ID | P81605 | 
| Refseq Size | 645 | 
| Cytogenetics | 12q13.2 | 
| Refseq ORF | 330 | 
| Synonyms | AIDD; DCD-1; DSEP; HCAP; PIF | 
| Summary | This antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014] | 
| Protein Families | Secreted Protein | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC403291 | DCD HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY403291 | Transient overexpression lysate of dermcidin (DCD) | 
                                                     CNY 3080.00  | 
                                            |
| PH309352 | DCD MS Standard C13 and N15-labeled recombinant protein (NP_444513) | 
                                                     CNY 19520.00  | 
                                            |
| TP701063 | Purified recombinant protein of Human dermcidin (DCD), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug | 
                                                     CNY 7106.00  | 
                                            
其它Dermcidin产品
