CSN1 (GPS1) (NM_212492) Human Recombinant Protein
CAT#: TP309147
Recombinant protein of human G protein pathway suppressor 1 (GPS1), transcript variant 1, 20 µg
View other "CSN1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209147 protein sequence
Red=Cloning site Green=Tags(s) MRDSSAPSSASSSVTDLYCTPHSSRSDLVLPGTAGDFSLSASLSACTLLYEGAVEPMQIDVDPQEDPQNA PDVNYVVENPSLDLEQYAASYSGLMRIERLQFIADHCPTLRVEALKMALSFVQRTFNVDMYEEIHRKLSE ATRELQNAPDAIPESGVEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLD CGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKAESTPEIAEQRGERDSQTQA ILTKLKCAAGLAELAARKYKQAAKCLLLASFDHCDFPELLSPSNVAIYGGLCALATFDRQELQRNVISSS SFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSA DMHRMAAAFNTTVAALEDELTQLILEGLISARVDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMM LRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTNM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 58.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_997657 |
| Locus ID | 2873 |
| UniProt ID | Q13098 |
| Refseq Size | 2363 |
| Cytogenetics | 17q25.3 |
| Refseq ORF | 1581 |
| Synonyms | COPS1; CSN1; SGN1 |
| Summary | This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. [provided by RefSeq, Mar 2016] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403953 | GPS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418202 | GPS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403953 | Transient overexpression lysate of G protein pathway suppressor 1 (GPS1), transcript variant 1 |
CNY 3080.00 |
|
| LY418202 | Transient overexpression lysate of G protein pathway suppressor 1 (GPS1), transcript variant 2 |
CNY 3080.00 |
|
| PH309147 | GPS1 MS Standard C13 and N15-labeled recombinant protein (NP_997657) |
CNY 19520.00 |
