RBM35A (ESRP1) (NM_017697) Human Recombinant Protein
CAT#: TP309131
Recombinant protein of human epithelial splicing regulatory protein 1 (ESRP1), transcript variant 1, 20 µg
View other "RBM35A" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209131 protein sequence
Red=Cloning site Green=Tags(s) MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKI DVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYSFFDLR KEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF ESGTCSKMELIDDNTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRD LALQRHKHHMGTRYIEVYKATGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHC PITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVLNRFSSAP LIPLPTPPIIPVLPQQFVPPTNVRDCIRLRGLPYAATIEDILDFLGEFATDIRTHGVHMVLNHQGRPSGD AFIQMKSADRAFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRNGLSPPPCKLPCLSPPSYTFP APAAVIPTEAAIYQPSVILNPRALQPSTAYYPAGTQLFMNYTAYYPSPPGSPNSLGYFPTAANLSGVPPQ PGTVVRMQGLAYNTGVKEILNFFQGYQYATEDGLIHTNDQARTLPKEWVCI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 75.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060167 |
| Locus ID | 54845 |
| UniProt ID | Q6NXG1 |
| Refseq Size | 3806 |
| Cytogenetics | 8q22.1 |
| Refseq ORF | 2043 |
| Synonyms | DFNB109; RBM35A; RMB35A |
| Summary | ESPR1 is an epithelial cell-type-specific splicing regulator (Warzecha et al., 2009 [PubMed 19285943]).[supplied by OMIM, Aug 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413607 | ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422113 | ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426568 | ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426569 | ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413607 | Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 1 |
CNY 3080.00 |
|
| LY422113 | Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 2 |
CNY 3080.00 |
|
| LY426568 | Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 3 |
CNY 3080.00 |
|
| LY426569 | Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 5 |
CNY 3080.00 |
|
| PH309131 | ESRP1 MS Standard C13 and N15-labeled recombinant protein (NP_060167) |
CNY 14250.00 |
|
| PH310539 | ESRP1 MS Standard C13 and N15-labeled recombinant protein (NP_001030087) |
CNY 19520.00 |
|
| TP310539 | Recombinant protein of human epithelial splicing regulatory protein 1 (ESRP1), transcript variant 2, 20 µg |
CNY 2900.00 |
