NUP43 (NM_198887) Human Recombinant Protein
CAT#: TP309014
Recombinant protein of human nucleoporin 43kDa (NUP43), transcript variant 1, 20 µg
View other "NUP43" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209014 protein sequence
Red=Cloning site Green=Tags(s) MEEIYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIGDFGNLDSDGGFEGDHQLLCD IRHHGDVMDLQFFDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCN NPEIVTVGEDGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQI LSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPEHLFTC SEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRS LSVNTLDVLGPCLVCGTDAEAIYVTRHLFS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_942590 |
Locus ID | 348995 |
UniProt ID | Q8NFH3 |
Refseq Size | 3894 |
Cytogenetics | 6q25.1 |
Refseq ORF | 1140 |
Synonyms | bA350J20.1; p42 |
Summary | Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404768 | NUP43 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404768 | Transient overexpression lysate of nucleoporin 43kDa (NUP43), transcript variant 1 |
CNY 3080.00 |
|
PH309014 | NUP43 MS Standard C13 and N15-labeled recombinant protein (NP_942590) |
CNY 19520.00 |