CSDC2 (NM_014460) Human Recombinant Protein
CAT#: TP308989
Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2), 20 µg
View other "CSDC2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208989 protein sequence
Red=Cloning site Green=Tags(s) MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFK GVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPH TPHETWSGQVVGS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_055275 |
| Locus ID | 27254 |
| UniProt ID | Q9Y534 |
| Refseq Size | 2545 |
| Cytogenetics | 22q13.2 |
| Refseq ORF | 459 |
| Synonyms | dJ347H13.2; PIPPIN |
| Summary | RNA-binding factor which binds specifically to the very 3' UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. Might play a central role in the negative regulation of histone variant synthesis in the developing brain (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415263 | CSDC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415263 | Transient overexpression lysate of cold shock domain containing C2, RNA binding (CSDC2) |
CNY 3080.00 |
|
| PH308989 | CSDC2 MS Standard C13 and N15-labeled recombinant protein (NP_055275) |
CNY 19520.00 |
|
| TP710146 | Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
