beta Catenin (CTNNB1) (NM_001904) Human Recombinant Protein
CAT#: TP308947
Recombinant protein of human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), 20 µg
View other "beta Catenin" proteins (15)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208947 representing NM_001904
Red=Cloning site Green=Tags(s) MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGF SQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLI NYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVET ARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQ KMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVC SSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG LPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQF VEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEA IEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDI GAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGD SNQLAWFDTDL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 85.3 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Pull-down assay (PMID: 27203386) |
| Reference Data | |
| RefSeq | NP_001895 |
| Locus ID | 1499 |
| UniProt ID | P35222 |
| Refseq Size | 3697 |
| Cytogenetics | 3p22.1 |
| Refseq ORF | 2343 |
| Synonyms | armadillo; CTNNB; EVR7; MRD19; NEDSDV |
| Summary | The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
| Protein Pathways | Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Basal cell carcinoma, Colorectal cancer, Endometrial cancer, Focal adhesion, Leukocyte transendothelial migration, Melanogenesis, Pathogenic Escherichia coli infection, Pathways in cancer, Prostate cancer, Thyroid cancer, Tight junction, Wnt signaling pathway |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Phosphorylation of E-cadherin at threonine 790 by protein kinase Cd reduces ß-catenin binding and suppresses the function of E-cadherin
,Chen, CL;Wang, SH;Chan, PC;Shen, MR;Chen, HC;,
Oncotarget
,PubMed ID 27203386
[CTNNB1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419662 | CTNNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420557 | CTNNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420558 | CTNNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426005 | CTNNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY419662 | Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 1 |
CNY 3080.00 |
|
| LY420557 | Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 2 |
CNY 4840.00 |
|
| LY420558 | Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 3 |
CNY 4840.00 |
|
| LY426005 | Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 2 |
CNY 4840.00 |
|
| PH308947 | CTNNB1 MS Standard C13 and N15-labeled recombinant protein (NP_001895) |
CNY 19520.00 |
|
| PH312056 | CTNNB1 MS Standard C13 and N15-labeled recombinant protein (NP_001091679) |
CNY 14250.00 |
|
| PH314557 | CTNNB1 MS Standard C13 and N15-labeled recombinant protein (NP_001091680) |
CNY 14250.00 |
|
| TP312056 | Recombinant protein of human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), 20 µg |
CNY 2900.00 |
|
| TP314557 | Recombinant protein of human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), 20 µg |
CNY 2900.00 |
|
| TP710027 | Recombinant protein of human human catenin (cadherin-associated protein), beta 1(CTNNB1), full length, with C-terminal DDK tag, expressed in sf9 cells |
CNY 4020.00 |
|
| TP710124 | Recombinant protein of human human catenin (cadherin-associated protein), beta 1(CTNNB1), full length, with N-terminal His tag, expressed in sf9 cells |
CNY 4020.00 |
其它beta Catenin产品


