BANF2 (NM_001014977) Human Recombinant Protein
CAT#: TP308893
Recombinant protein of human barrier to autointegration factor 2 (BANF2), transcript variant 2, 20 µg
View other "BANF2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208893 protein sequence
Red=Cloning site Green=Tags(s) MDDMSPRLRAFLSEPIGEKDVCWVDGISHELAINLVTKGINKAYILLGQFLLMHKNEAEFQRWLICCFGA TECEAQQTSHCLKEWCACFL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001014977 |
Locus ID | 140836 |
UniProt ID | Q9H503 |
Refseq Size | 466 |
Cytogenetics | 20p12.1 |
Refseq ORF | 270 |
Synonyms | BAF-L; BAF2; BAFL; C20orf179 |
Summary | May play a role in BANF1 regulation and influence tissue-specific roles of BANF1.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405884 | BANF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423098 | BANF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405884 | Transient overexpression lysate of barrier to autointegration factor 2 (BANF2), transcript variant 1 |
CNY 3080.00 |
|
LY423098 | Transient overexpression lysate of barrier to autointegration factor 2 (BANF2), transcript variant 2 |
CNY 3080.00 |
|
PH308893 | BANF2 MS Standard C13 and N15-labeled recombinant protein (NP_001014977) |
CNY 19520.00 |
|
PH309388 | BANF2 MS Standard C13 and N15-labeled recombinant protein (NP_848572) |
CNY 19520.00 |
|
TP309388 | Recombinant protein of human barrier to autointegration factor 2 (BANF2), transcript variant 1, 20 µg |
CNY 2900.00 |