NPM3 (NM_006993) Human Recombinant Protein
CAT#: TP308869
Recombinant protein of human nucleophosmin/nucleoplasmin, 3 (NPM3), 20 µg
View other "NPM3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208869 protein sequence
Red=Cloning site Green=Tags(s) MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLC LTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIV TMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_008924 |
| Locus ID | 10360 |
| UniProt ID | O75607 |
| Refseq Size | 904 |
| Cytogenetics | 10q24.32 |
| Refseq ORF | 534 |
| Synonyms | PORMIN; TMEM123 |
| Summary | The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus. [provided by RefSeq, Oct 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416276 | NPM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416276 | Transient overexpression lysate of nucleophosmin/nucleoplasmin 3 (NPM3) |
CNY 3080.00 |
|
| PH308869 | NPM3 MS Standard C13 and N15-labeled recombinant protein (NP_008924) |
CNY 19520.00 |
