GSK3 alpha (GSK3A) (NM_019884) Human Recombinant Protein
CAT#: TP308698
Recombinant protein of human glycogen synthase kinase 3 alpha (GSK3A), 20 µg
View other "GSK3 alpha" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208698 protein sequence
Red=Cloning site Green=Tags(s) MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPG GSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAE TRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFT KAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYI CSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPN YTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 50.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | In vitro kinase assay (enzyme) (PMID: 26618561) Thermophoresis assay (PMID: 26618561) |
| Reference Data | |
| RefSeq | NP_063937 |
| Locus ID | 2931 |
| UniProt ID | P49840 |
| Refseq Size | 2200 |
| Cytogenetics | 19q13.2 |
| Refseq ORF | 1449 |
| Summary | This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease. [provided by RefSeq, Oct 2011] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Chemokine signaling pathway |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Direct High Affinity Interaction between Aß42 and GSK3a Stimulates Hyperphosphorylation of Tau. A New Molecular Link in Alzheimer's Disease?
,Dunning, CJ;McGauran, G;Willén, K;Gouras, GK;O'Connell, DJ;Linse, S;,
ACS Chem Neurosci
,PubMed ID 26618561
[GSK3A]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412674 | GSK3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412674 | Transient overexpression lysate of glycogen synthase kinase 3 alpha (GSK3A) |
CNY 3080.00 |
|
| PH308698 | GSK3A MS Standard C13 and N15-labeled recombinant protein (NP_063937) |
CNY 19520.00 |
其它GSK3 alpha产品
