POU6F1 (NM_002702) Human Recombinant Protein
CAT#: TP308598
Recombinant protein of human POU class 6 homeobox 1 (POU6F1), transcript variant 1, 20 µg
View other "POU6F1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208598 protein sequence
Red=Cloning site Green=Tags(s) MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPPPVAV RKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDED GINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLN EAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRV WFCNRRQTLKNTSKLNVFQIP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002693 |
| Locus ID | 5463 |
| UniProt ID | Q14863 |
| Refseq Size | 4715 |
| Cytogenetics | 12q13.13 |
| Refseq ORF | 903 |
| Synonyms | BRN5; MPOU; TCFB1 |
| Summary | Transcription factor that binds preferentially to a variant of the octamer motif (5'-ATGATAAT-3').[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419157 | POU6F1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419157 | Transient overexpression lysate of POU class 6 homeobox 1 (POU6F1), transcript variant 1 |
CNY 3080.00 |
|
| PH308598 | POU6F1 MS Standard C13 and N15-labeled recombinant protein (NP_002693) |
CNY 19520.00 |
