CPA4 (NM_016352) Human Recombinant Protein
CAT#: TP308575
Recombinant protein of human carboxypeptidase A4 (CPA4), 20 µg
View other "CPA4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208575 protein sequence
Red=Cloning site Green=Tags(s) MRWILFIGALIGSSICGQEKFFGDQVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPS VSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADF PDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITS ILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGP HANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEY QVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNL Y myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 45.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057436 |
| Locus ID | 51200 |
| UniProt ID | Q9UI42 |
| Refseq Size | 2817 |
| Cytogenetics | 7q32.2 |
| Refseq ORF | 1263 |
| Synonyms | CPA3 |
| Summary | This gene is a member of the carboxypeptidase A/B subfamily, and it is located in a cluster with three other family members on chromosome 7. Carboxypeptidases are zinc-containing exopeptidases that catalyze the release of carboxy-terminal amino acids, and are synthesized as zymogens that are activated by proteolytic cleavage. This gene could be involved in the histone hyperacetylation pathway. It is imprinted and may be a strong candidate gene for prostate cancer aggressiveness. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402543 | CPA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431341 | CPA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402543 | Transient overexpression lysate of carboxypeptidase A4 (CPA4), transcript variant 1 |
CNY 3080.00 |
|
| LY431341 | Transient overexpression lysate of carboxypeptidase A4 (CPA4), transcript variant 2 |
CNY 3080.00 |
|
| PH308575 | CPA4 MS Standard C13 and N15-labeled recombinant protein (NP_057436) |
CNY 19520.00 |

