FTCD (NM_006657) Human Recombinant Protein
CAT#: TP308573
Recombinant protein of human formiminotransferase cyclodeaminase (FTCD), transcript variant B, 20 µg
View other "FTCD" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208573 protein sequence
Red=Cloning site Green=Tags(s) MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVAS RLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPA IRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGK DQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLD AAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGAR SAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYL EAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMG VFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 58.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006648 |
Locus ID | 10841 |
UniProt ID | O95954 |
Refseq Size | 1921 |
Cytogenetics | 21q22.3 |
Refseq ORF | 1623 |
Synonyms | LCHC1 |
Summary | The protein encoded by this gene is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. Mutations in this gene are associated with glutamate formiminotransferase deficiency. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Dec 2009] |
Protein Pathways | Histidine metabolism, Metabolic pathways, One carbon pool by folate |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404121 | FTCD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC416500 | FTCD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404121 | Transient overexpression lysate of formiminotransferase cyclodeaminase (FTCD), transcript variant A |
CNY 4840.00 |
|
LY416500 | Transient overexpression lysate of formiminotransferase cyclodeaminase (FTCD), transcript variant B |
CNY 3080.00 |
|
PH308573 | FTCD MS Standard C13 and N15-labeled recombinant protein (NP_006648) |
CNY 19520.00 |