FAM83A (NM_032899) Human Recombinant Protein
CAT#: TP308565
Recombinant protein of human family with sequence similarity 83, member A (FAM83A), transcript variant 1, 20 µg
View other "FAM83A" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208565 protein sequence
Red=Cloning site Green=Tags(s) MSRSRHLGKIRKRLEDVKSQWVRPARADFSDNESARLATDALLDGGSEAYWRVLSQEGEVDFLSSVEAQY IQAQAREPPCPPDTLGGAEAGPKGLDSSSLQSGTYFPVASEGSEPALLHSWASAEKPYLKEKSSATVYFQ TVKHNNIRDLVRRCITRTSQVLVILMDVFTDVEIFCDILEAANKRGVFVCVLLDQGGVKLFQEMCDKVQI SDSHLKNISIRSVEGEIYCAKSGRKFAGQIREKFIISDWRFVLSGSYSFTWLCGHVHRNILSKFTGQAVE LFDEEFRHLYASSKPVMGLKSPRLVAPVPPGAAPANGRLSSSSGSASDRTSSNPFSGRSAGSHPGTRSVS ASSGPCSPAAPHPPPPPRFQPHQGPWGAPSPQAHLSPRPHDGPPAAVYSNLGAYRPTRLQLEQLGLVPRL TPTWRPFLQASPHF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116288 |
Locus ID | 84985 |
UniProt ID | Q86UY5 |
Refseq Size | 4596 |
Cytogenetics | 8q24.13 |
Refseq ORF | 1302 |
Synonyms | BJ-TSA-9 |
Summary | Probable proto-oncogene that functions in the epidermal growth factor receptor/EGFR signaling pathway. Activates both RAS/MAPK and PI3K/AKT/TOR signaling cascades downstream of EGFR. Required for the RAS/MAPK signaling cascade activation upon EGFR stimulation, it also activates both signaling cascades independently of EGFR activation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404130 | FAM83A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409861 | FAM83A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404130 | Transient overexpression lysate of family with sequence similarity 83, member A (FAM83A), transcript variant 2 |
CNY 3080.00 |
|
LY409861 | Transient overexpression lysate of family with sequence similarity 83, member A (FAM83A), transcript variant 1 |
CNY 3080.00 |
|
PH308565 | FAM83A MS Standard C13 and N15-labeled recombinant protein (NP_116288) |
CNY 19520.00 |